elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Insulin-Like Growth Factor I/IGF-I/IGF1

Recombinant Human Insulin-Like Growth Factor I/IGF-I/IGF1 Recombinant Human Insulin-Like Growth Factor I/IGF-I/IGF1

Instruction Manual!

Product name: Recombinant Human Insulin-Like Growth Factor I/IGF-I/IGF1
Source:E.coli
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of 300mM NaAc, pH 6.5.
Applications:SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP)
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source E.coli
Description Recombinant Human Insulin-like Growth Factor I is produced by our E.coli expression system and the target gene encoding Thr52-Ala118 is expressed.
Names Insulin-Like Growth Factor I, IGF-I, Mechano Growth Factor, MGF, Somatomedin-C, IGF1, IBP1
Accession # P05019
Formulation Lyophilized from a 0.2 μm filtered solution of 300mM NaAc, pH 6.5.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 500mM Acetic Acid.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.05 ng/µg (0.5 IEU/µg) as determined by LAL test.
Amino Acid Sequence
TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAK SA
Background Insulin-like growth factor I (IGF1) belongs to the family of insulin-like growth factors that are structurally homologous to proinsulin. Mature IGFs are generated by proteolytic processing of inactive precursor protein containing N-terminal and C-terminal propeptide regions. Mature human IGF-I consisting of 70 amino acids with 94% identity with mouse IGF1 and exhibits cross-species activity. IGF1 binds IGF-1R, IGF-2R, and the insulin receptor and plays a key role in cell cycle progression, cell proliferation and tumor progression. IGF1 expression is regulated by growth hormone.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese