elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Insulin-Like Growth Factor I/IGF-I/IGF1

Recombinant Human Insulin-Like Growth Factor I/IGF-I/IGF1 Recombinant Human Insulin-Like Growth Factor I/IGF-I/IGF1

Instruction Manual!

Product name: Recombinant Human Insulin-Like Growth Factor I/IGF-I/IGF1
Source:E.coli
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of 300mM NaAc, pH 6.5.
Applications:SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP)
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source E.coli
Description Recombinant Human Insulin-like Growth Factor I is produced by our E.coli expression system and the target gene encoding Gly49-Ala118 is expressed.
Names Insulin-Like Growth Factor I, IGF-I, Mechano Growth Factor, MGF, Somatomedin-C, IGF1, IBP1
Accession # P05019
Formulation Lyophilized from a 0.2 μm filtered solution of 300mM NaAc, pH 6.5.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in 500mM Acetic Acid.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Biological Activity ED50 is greater than 200 ng/ml.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.05 ng/µg (0.5 IEU/µg) as determined by LAL test.
Amino Acid Sequence
GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLK PAKSA
Background Insulin-like growth factor I (IGF1) belongs to the family of insulin-like growth factors that are structurally homologous to proinsulin. Mature IGFs are generated by proteolytic processing of inactive precursor proteins, which contains the N- and C-terminal propeptide regions. Mature human IGF-I consisting of 70 amino acids has 94% identity with mouse IGF-I and exhibits cross-species activity. IGF-1 binds IGF-IR, IGF-IIR, and the insulin receptor and plays a key role in cell cycle progression, cell proliferation and tumor progression. IGF-1 expression is regulated by growth hormone. R3 IGF-1 is an 83 amino acid analog of IGF-1 comprising the complete human IGF-1 sequence with the substitution of an Arg (R) for the Glu(E) at position three, hence R3, and a 13 amino acid extension peptide at the N terminus. R3 IGF-1 has been produced with the purpose of increasing biological activity. R3 IGF-1 is significantly more potent than human IGF-I in vitro.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese