Recombinant Human Insulin-Like Growth Factor-Binding Protein 4/IGFBP-4
Product name: | Recombinant Human Insulin-Like Growth Factor-Binding Protein 4/IGFBP-4 |
Source: | E.coli |
Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
Applications: | SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP) |
Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months. |
UOM: | 100ug/50ug/200ug/1mg/1g |
Source | Human Cells |
Description | Recombinant Human Insulin-Like Growth Factor-Binding Protein 4 is produced by our Mammalian expression system and the target gene encoding Asp22-Glu258 is expressed with a 6His tag at the C-terminus. |
Names | Insulin-Like Growth Factor-Binding Protein 4, IBP-4, IGF-Binding Protein 4, IGFBP-4, IGFBP4, IBP4 |
Accession # | P22692 |
Formulation | Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2. |
Shipping |
The product is shipped at ambient temperature. |
Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Amino Acid Sequence |
DEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCALGLGMPCGVYTPRCGSGLRCYPPRGV EKPLHTLMHGQGVCMELAEIEAIQESLQPSDKDEGDHPNNSFSPCSAHDRRCLQKHFAKIRDRST SGGKMKVNGAPREDARPVPQGSCQSELHRALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCH PALDGQRGKCWCVDRKTGVKLPGGLEPKGELDCHQLADSFREVDHHHHHH
|
Background | IGFBP-4, whose full name is insulin-like growth factor-binding protein 4, is induced by forskolin and N6, O2’dibutyryl sdenosine 3’, or 5’-cyclic monophosphate. It contains IGFBP N-terminal domain and thyroglobulin type-1 domain, and can bind IGF2. The IGF-binding proteins can prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. |