elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Ephrin-B2/EFNB2

Recombinant Human Ephrin-B2/EFNB2 Recombinant Human Ephrin-B2/EFNB2

Instruction Manual!

Product name: Recombinant Human Ephrin-B2/EFNB2
Source:E.coli
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Applications:SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP)
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source Human Cells
Description Recombinant Human Ephrin-B2 is produced by our Mammalian expression system and the target gene encoding Ile28-Ala229 is expressed with a 6His tag at the C-terminus.
Names Ephrin-B2, EPH-Related Receptor Tyrosine Kinase Ligand 5, LERK-5, HTK Ligand, HTK-L, EFNB2, EPLG5, HTKL, LERK5
Accession # P52799
Formulation Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
IVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIK KENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRA MKILMKVGQDASSAGSTRNKDPTRRPELEAGTNGRSSTTSPFVKPNPGSSTDGNSAGHSGNNILG SEVALFAVDHHHHHH
Background Ephrin-B2 is a type I transmembrane protein and belongs the Ephrin family. It binds to the receptor tyrosine kinases, such as EPHA4, EPHB4 and EPHA3. Ephrin-B2 has been implicated in mediating developmental events, especially in the nervous system, erythropoiesis and tumour metastasis. Ligation of Ephrin-B2 with complementary EphB receptors on adjacent cells results in a combination of forward (EphB receptors) and reverse (Ephrin-B2) signalling, which is central to tissue development and remodelling functions. In addition, Ephrin-B2 may play a role in constraining the orientation of longitudinally projecting axons.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese