elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Transforming Growth Factor α/TGFα

Recombinant Human Transforming Growth Factor α/TGFα Recombinant Human Transforming Growth Factor α/TGFα

Instruction Manual!

Product name: Recombinant Human Transforming Growth Factor α/TGFα
Source:E.coli
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of 10mM Acetic Acid .
Applications:SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP)
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source E.coli
Description Recombinant Human Transforming Growth Factor alpha is produced by our E.coli expression system and the target gene encoding Val41-Val90 is expressed.
Names Protransforming Growth Factor Alpha, TGF-Alpha, EGF-Like TGF, ETGF, TGF Type 1, TGFA
Accession # P01135
Formulation Lyophilized from a 0.2 μm filtered solution of 10mM Acetic Acid .
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
VSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAV
Background Transforming Growth Factor α (TGF-α) belongs to the EGF family of cytokines. It is a mitogenic polypeptide and secreted protein, which is expressed by monocytes, keratinocytes, and various tumor cells. TGFα contains two chains, protransforming growth factor α and transforming growth factor α. It can bind to the EGF receptor that synergistically with TGFβ to stimulate anchorage-independent cell proliferation and produce a mitogenic response. TGFα interacts with the PDZ domains of MAGI3, SDCBP and SNTA1. The interaction with SDCBP is required for the targeting to the cell surface.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese