Recombinant Human Cerberus 1/DAND4

Instruction Manual!

Product name:	Recombinant Human Cerberus 1/DAND4
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM HAc.
Applications:	SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP)
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Cerberus 1 is produced by our Mammalian expression system and the target gene encoding Thr18-Ala267 is expressed with a 6His tag at the C-terminus.
Names	Cerberus, Cerberus-Related Protein, DAN Domain Family Member 4, CER1, DAND4
Accession #	O95813
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM HAc.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	TRHQDGRQNQSSLSPVLLPRNQRELPTGNHEEAEEKPDLFVAVPHLVGTSPAGEGQRQREKMLSR FGRFWKKPEREMHPSRDSDSEPFPPGTQSLIQPIDGMKMEKSPLREEAKKFWHHFMFRKTPASQG VILPIKSHEVHWETCRTVPFSQTITHEGCEKLVVQNNLCFGKCGSVHFPGAAQHSHTSCSHCLPA KFTTMHLPLNCTELSSVIKVVMLVEECQCKVKTEHEDGHILHAGSQDSFIPGVSAVDHHHHHH
Background	Cerberus 1 is a secreted glycoprotein that forms disulfide-linked homodimers. It is a cytokine member of the DAN domain family of BMP antagonists that includes DAN (DAND1), Gremlin/Drm (DAND2), PRDC (Protein Related to Dan and Cerberus, DAND3), and COCO/Dante (DAND5). DAN family members contain a cysteine knot domain that is homologous to that found in other TGF-beta superfamily ligands. At the onset of gastrulation, Cerberus 1 is transiently expressed in anterior endodermal structures in response to Nodal and Shh. Cerberus 1 binds BMP-4 and Nodal and inhibits their activities. The inhibitory functions of Cerberus favor mesodermal development in the anterior region of the gastrula and suppresses posterior mesodermal differentiation. In chick and Xenopus, Cerberus 1 also regulates, but is not required for embryonic left-right polarization, neurulation, and head and heart induction.