Recombinant Human Fibroblast Growth Factor 6/FGF-6
Product name: | Recombinant Human Fibroblast Growth Factor 6/FGF-6 |
Source: | E.coli |
Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of 20mM Tris,500mM NaCl,pH8.0. |
Applications: | SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP) |
Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months. |
UOM: | 100ug/50ug/200ug/1mg/1g |
Source | E.coli |
Description | Recombinant Human Fibroblast Growth Factor 6 is produced by our E.coli expression system and the target gene encoding Gly41-Ile208 is expressed. |
Names | Fibroblast Growth Factor 6, FGF-6, Heparin Secretory-Transforming Protein 2, HST-2, HSTF-2, Heparin-Binding Growth Factor 6, HBGF-6, FGF6, HST2, HSTF2 |
Accession # | P10767 |
Formulation | Lyophilized from a 0.2 μm filtered solution of 20mM Tris,500mM NaCl,pH8.0. |
Shipping |
The product is shipped at ambient temperature. |
Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Amino Acid Sequence |
GTRANNTLLDSRGWGTLLSRSRAGLAGEIAGVNWESGYLVGIKRQRRLYCNVGIGFHLQVLPDGR ISGTHEENPYSLLEISTVERGVVSLFGVRSALFVAMNSKGRLYATPSFQEECKFRETLLPNNYNA YESDLYQGTYIALSKYGRVKRGSKVSPIMTVTHFLPRI
|
Background | Fibroblast Growth Factor 6 (FGF-6) is a secreted protein member of the heparin-binding growth factors family. FGF family members possess broad mitosis and cell survival activities and are involved in a variety of biological processes. Affinity between fibroblast growth factors (FGFs) and their receptors is increased by heparan sulfate glycosaminoglycans that function as coreceptors. FGF6 plays an important role in the regulation of cell proliferation, cell differentiation, angiogenesis and myogenesis, and is required for normal muscle regeneration. |