elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Transforming Growth Factor β-2/TGFB2

Recombinant Human Transforming Growth Factor β-2/TGFB2 Recombinant Human Transforming Growth Factor β-2/TGFB2

Instruction Manual!

Product name: Recombinant Human Transforming Growth Factor β-2/TGFB2
Source:E.coli
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of 4 mM HCl.
Applications:SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP)
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
ource Human Cells
Description Recombinant Human Transforming Growth Factor beta 2 is produced by our Mammalian expression system and the target gene encoding Ala303-Ser414 is expressed.
Names Transforming growth factor beta-2,TGFB2,Polyergin,G-TSF,Glioblastoma-derived T-cell suppressor factor,Cetermin,BSC-1 cell growth inhibitor,TGF-beta-2
Accession # P61812
Formulation Lyophilized from a 0.2 μm filtered solution of 4 mM HCl.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLY NTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS
Background Transforming growth factor beta-2 (TGF-β2) is a secreted protein which belongs to the TGF-beta family. It is known as a cytokine that performs many cellular functions and has a vital role during embryonic development. The precursor is cleaved into mature TGF-beta-2 and LAP, which remains non-covalently linked to mature TGF-beta-2 rendering it inactive. It is an extracellular glycosylated protein. It is known to suppress the effects of interleukin dependent T-cell tumors. Defects in TGFB2 may be a cause of non-syndromic aortic disease (NSAD).

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese