Recombinant Rat VEGF-A/VEGF164
| Product name: | Recombinant Rat VEGF-A/VEGF164 |
| Source: | E.coli |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. |
| Applications: | SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP) |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months. |
| UOM: | 100ug/50ug/200ug/1mg/1g |
| Source | P.Pichia |
| Description | Recombinant Rat Vascular Endothelial Growth Factor A is produced by our Yeast expression system and the target gene encoding Ala27-Arg190 is expressed. |
| Names | Vascular endothelial growth factor A,Vascular permeability factor,VEGF/VEGF-A/VPF |
| Accession # | P16612-2 |
| Formulation | Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4. |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Amino Acid Sequence |
APTTEGEQKTHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEAL ECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQD PQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
|
| Background | Vascular endothelial growth factor (VEGF/VEGF-A ) is originally known as vascular permeability factor (VPF). It belongs to the PDGF family with a cysteine-knot structure comprised of eight conserved cysteine residues, and reckoned as a potent mediator in the process of angiogenesis and vasculogenesis in either fetus or adult. VEGF is particularly expressed in supraoptic , paraventricular nuclei and the choroid plexus of the pituitary, and abundant in the corpus luteum of the ovary and in kidney glomeruli. The rat VEGF protein contains a putative 20 amino acids (aa) signal peptide, and alternative splicing of rat VEGF gene produces isoforms of 120, 144, 164 and 188 aa. Rat VEGF164 respectively displays 97% and 88% aa identity with that regions of mouse and human VEGF. VEGF can bind to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin, and play important roles in inducing endothelial cell proliferation, promoting cell migration, inhibiting apoptosis and inducing permeabilization of blood vessels. |












