elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human PDGF-Associated Protein/PAP

Recombinant Human PDGF-Associated Protein/PAP Recombinant Human PDGF-Associated Protein/PAP

Instruction Manual!

Product name: Recombinant Human PDGF-Associated Protein/PAP
Source:E.coli
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Supplied as a 0.2 μm filtered solution of 20mM Tris, 100mM NaCl, 0.1mM PMSF, 2mM DTT, pH 8.0.
Applications:SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP)
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source E.coli
Description Recombinant Human PDGF-Associated Protein is produced by our E.coli expression system and the target gene encoding Met1-Lys181 is expressed with a 6His tag at the N-terminus.
Names 28 kDa Heat- and Acid-Stable Phosphoprotein, PDGF-Associated Protein, PAP, PDGFA-Associated Protein 1, PAP1, PDAP1, HASPP28
Accession # Q13442
Formulation Supplied as a 0.2 μm filtered solution of 20mM Tris, 100mM NaCl, 0.1mM PMSF, 2mM DTT, pH 8.0.
Shipping The product is shipped on dry ice/ice packs.
Storage Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
MGSSHHHHHHSSGLVPRGSHMPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGD GAAGDPKKEKKSLDSDESEDEEDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRR EREEIEKQKAKERYMKMHLAGKTEQAKADLARLAIIRKQREEAARKKEEERKAKDDATLSGKRMQ SLSLNK
Background Human PAP, also known as 28 kDa heat- and acid-stable phosphoprotein, PDGF-associated protein, PDGFA-associated protein 1, PDAP1, HASPP28, is a protein which belongs to the PDAP1 family. The encoded protein in rodents has been shown to bind PDGFA with a low affinity. PDGF-Associated Protein (PAP) is a phosphoprotein that may enhance PDGFA-stimulated cell growth in fibroblasts, but inhibits the mitogenic effect of PDGFB. PDAP1 expression is induced by TNF-alpha, and cells overexpressing PDAP1 show significantly less apoptosis on exposure to TNF-alpha.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese