elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Fibroblast Growth Factor 23/FGF-23

Recombinant Human Fibroblast Growth Factor 23/FGF-23 Recombinant Human Fibroblast Growth Factor 23/FGF-23

Instruction Manual!

Product name: Recombinant Human Fibroblast Growth Factor 23/FGF-23
Source:E.coli
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,1mM EDTA,2mMDTT,pH7.4.
Applications:SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP)
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source Human Cells
Description Recombinant Human Fibroblast Growth Factor 23 is produced by our Mammalian expression system and the target gene encoding Tyr25-Ile251 is expressed with a 6His tag at the C-terminus.
Names Fibroblast Growth Factor 23, FGF-23, Phosphatonin, Tumor-Derived Hypophosphatemia-Inducing Factor, FGF23, HYPF
Accession # Q9GZV9
Formulation Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,1mM EDTA,2mMDTT,pH7.4.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVM SRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPY SQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPM ASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFIVDHHHHHH
Background Fibroblast Growth Factor 23 (FGF-23) is a secreted protein that belongs to the heparin-binding growth factors family. FGF-23 is expressed in osteogenic cells, particularly during phases of active bone remodeling. FGF family members possess broad mitogenic and cell survival activities, involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth, and invasion. FGF-23 regulates homeostasis of phosphate and vitamin-D metabolism. FGF-23 inhibits renal tubular phosphate transport by reducing SLC34A1 levels, and negatively regulates osteoblast differentiation and matrix mineralization. FGF-23 also upregulates EGR1 expression in the presence of KL, acts directly on the parathyroid to decrease PTH secretion. Defects in FGF-23 are the cause of autosomal dominant hypophosphataemic rickets (ADHR).
References

Exercise-stimulated FGF23 promotes exercise performance via controlling the excess reactive oxygen species production and enhancing mitochondrial function in skeletal muscle

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese