elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Hepatoma-Derived Growth Factor/HDGF

Recombinant Human Hepatoma-Derived Growth Factor/HDGF Recombinant Human Hepatoma-Derived Growth Factor/HDGF

Instruction Manual!

Product name: Recombinant Human Hepatoma-Derived Growth Factor/HDGF
Source:E.coli
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 1mM DTT, 1mM EDTA, pH 7.5.
Applications:SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP)
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 degree C for one month. Aliquot and store at -80 degree C for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source E.coli
Description Recombinant Human Hepatoma-Derived Growth Factor is produced by our E.coli expression system and the target gene encoding Met1-Tyr100 is expressed with a 6His tag at the C-terminus.
Names Hepatoma-Derived Growth Factor, HDGF, High Mobility Group Protein 1-Kike 2, HMG-1L2, HDGF, HMG1L2
Accession # P51858
Formulation Lyophilized from a 0.2 μm filtered solution of 20mM Tris, 1mM DTT, 1mM EDTA, pH 7.5.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
MSRSNRQKEYKCGDLVFAKMKGYPHWPARIDEMPEAAVKSTANKYQVFFFGTHETAFLGPKDLFP YEESKEKFGKPNKRKGFSEGLWEIENNPTVKASGYLEHHHHHH
Background Hepatoma-Derived Growth Factor is a original member of the HDGF family. HDGF is a cytoplasmic protein and contains one PWWP domain. HDGF expression levels are high in the nucleus and cytoplasm of smooth muscle and endothelial cells. HDGF has proliferative, angiogenic and neurotrophic activity. HDGF was initially characterized as a secreted mitogen from the Huh-7 human hepatoma cell line. As a heparin-binding protein, which is highly expressed in tumor cells where it stimulates proliferation. HDGF has mitogenic activity for fibroblasts and acts as a transcriptional repressor. It has been shown that HDGF is linked with tumorigenesis and the growth of cancer.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese