elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Interleukin-11/IL-11

Recombinant Human Interleukin-11/IL-11 Recombinant Human Interleukin-11/IL-11

Instruction Manual!

Product name: Recombinant Human Interleukin-11/IL-11
Source:E. coli
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of 20mM PB, 2% Glycine, pH 7.2.
Applications:SDS-PAGE, Western Blot (WB), ELISA (EIA), Immunoprecipitation (IP)
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source E. coli
Description Recombinant Human Interleukin-11 is produced by our Yeast expression system and the target gene encoding Gly23-Leu199 is expressed.
Names Interleukin-11, IL-11, Adipogenesis Inhibitory Factor, AGIF, Oprelvekin, IL11
Accession # P20809
Formulation Lyophilized from a 0.2 μm filtered solution of 20mM PB, 2% Glycine, pH 7.2.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Biological Activity ED50 is less than 0.2 ng/ml. Specific Activity of 8.0 x 10^6 IU/ mg, measured by the dose-dependent stimulation of murine 7TD1 proliferation.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
GPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGA LQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQP PPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Background Interleukin 11 (IL-11) is a thrombopoietic growth factor that directly stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production. IL-11 is a member of a family of human growth factors that includes human growth hormone, granulocyte colony-stimulating factor, and other growth factors.
References

Temozolomide resistance in glioblastoma occurs by miRNA-9-targeted PTCH1, independent of sonic hedgehog level.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese