elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Interferon α-6/IFNA6

Recombinant Human Interferon α-6/IFNA6 Recombinant Human Interferon α-6/IFNA6

Instruction Manual!

Product name: Recombinant Human Interferon α-6/IFNA6
Source:E.coli
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source Human Cells
Description Recombinant Human Interferon alpha-6 is produced by our Mammalian expression system and the target gene encoding Ser21-Glu189 is expressed with a 6His tag at the C-terminus.
Names Interferon Alpha-6, IFN-Alpha-6, Interferon Alpha-54, Interferon Alpha-K, LeIF K, IFNA6
Accession # P05013
Formulation Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
SLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFRFPQEEFDGNQFQKAEAISVLHEVIQ QTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLEACVMQEVWVGGTPLMNEDSILAVRKYFQRI TLYLTEKKYSPCAWEVVRAEIMRSFSSSRNLQERLRRKEVDHHHHHH
Background Interferon α-6 (IFN-α6) is a secreted protein which belongs to the α/β interferon family. IFN-α6 is produced by macrophages, expressed at low level, only 1.0% of the average gene in this release. IFN-α6 contains interferon alpha, beta and delta domain. IFN-α has antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese