Recombinant Mouse C-C Motif Chemokine 21a/CCL21a//6Ckine

Instruction Manual!

Product name:	Recombinant Mouse C-C Motif Chemokine 21a/CCL21a//6Ckine
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB，150mM NaCl,pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E. coli
Description	Recombinant Mouse C-C Motif Chemokine 21a is produced by our E.coli expression system and the target gene encoding Ser24-Gly133 is expressed.
Names	C-C Motif Chemokine 21a, 6Ckine, Beta-Chemokine Exodus-2, Small-Inducible Cytokine A21a, Thymus-Derived Chemotactic Agent 4, TCA4, Ccl21a, Scya21, Scya21a
Accession #	P84444
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB，150mM NaCl,pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFSPRKHSKPELCANPEEGWVQNLMR RLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG
Background	C-C Motif Chemokine 21a (CCL21a) is a small secreted cytokine that belongs to the intercrine beta (CC chemokine) family. Mouse CCL21 cDNA encodes a 133 amino acid residue protein with a 23 residue signal peptide that is cleaved to generate the 110 residue mature protein. Mouse CCL21 has three forms while CCL21a has Ser-65. CCL21 elicits its effects by binding to a cell surface chemokine receptor known as CCR7 and CXCR3. Mouse CCL21 inhibits hemopoiesis and stimulates chemotaxis. It has chemotactic function in vitro for thymocytes and activated T-cells, but not for B-cells, macrophages, or neutrophils. Mouse CCL21 shows preferential activity towards naive T-cells and may play a role in mediating homing of lymphocytes to secondary lymphoid organs.