Recombinant Mouse C-C Motif Chemokine 9/CCL9//MIP-1-γ
Product name: | Recombinant Mouse C-C Motif Chemokine 9/CCL9//MIP-1-γ |
Source: | E.coli |
Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl,300mM NaCl,pH8.0. |
Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
UOM: | 100ug/50ug/200ug/1mg/1g |
Source | E. coli |
Description | Recombinant Mouse C-C Motif Chemokine 9 is produced by our E.coli expression system and the target gene encoding Gln22-Gln122 is expressed. |
Names | C-C motif chemokine 9, CCF18, Macrophage inflammatory protein 1-gamma, Macrophage inflammatory protein-related protein 2, Small-inducible cytokine A9, Scya10,Scya9 and CCL9. |
Accession # | P51670 |
Formulation | Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl,300mM NaCl,pH8.0. |
Shipping |
The product is shipped at ambient temperature. |
Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Amino Acid Sequence |
MQITHATETKEVQSSLKAQQGLEIEMFHMGFQDSSDCCLSYNSRIQCSRFIGYFPTSGGCTRPGI IFISKRGFQVCANPSDRRVQRCIERLEQNSQPRTYKQ
|
Background | Mouse CCL9 is a small cytokine belonging to the CC chemokine family. It is expressed mainly in the liver, lung, and the thymus, although some expression has been detected in a wide variety of tissues except brain. CCL9 can activate osteoclasts through its receptor CCR1 (the most abundant chemokine receptor found on osteoclasts) suggesting an important role for CCL9 in bone resorption. |