elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human C-C Motif Chemokine 5/CCL5/RANTES

Recombinant Human C-C Motif Chemokine 5/CCL5/RANTES Recombinant Human C-C Motif Chemokine 5/CCL5/RANTES

Instruction Manual!

Product name: Recombinant Human C-C Motif Chemokine 5/CCL5/RANTES
Source:Human Cells
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source Human Cells
Description Recombinant Human C-C Motif Chemokine 5 is produced by our Mammalian expression system and the target gene encoding Ser24-Ser91 is expressed with a Fc, 6His tag at the C-terminus.
Names C-C Motif Chemokine 5, EoCP, Eosinophil Chemotactic Cytokine, SIS-Delta, Small-Inducible Cytokine A5, T Cell-Specific Protein P228, TCP228, T-Cell-Specific Protein RANTES, CCL5, D17S136E, SCYA5
Accession # P13501
Formulation Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSL EMSVDDIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSH EDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE KTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVL DSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Background Human Chemokine (C-C Motif) Ligand 5 (CCL5) plays an active role in recruiting leukocytes into inflammatory sites. CCL5 is secreted by many cell types at inflammatory sites and it exerts a wide range of activities through the receptors CCR1, CCR3, CCR4, and CCR5. N-Terminal truncated CCL5/RANTES, Met-RANTES, and amino-oxypentane (AOP)-RANTES exhibit antagonist or partial agonist functions on their receptors. CCL5/RANTES attracts different subtypes of leukocytes into inflamed tissue and intervenes in a wide range of allergic and autoimmune diseases.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese