elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Mouse C-C motif chemokine 2/CCL2

Recombinant Mouse C-C motif chemokine 2/CCL2 Recombinant Mouse C-C motif chemokine 2/CCL2

Instruction Manual!

Product name: Recombinant Mouse C-C motif chemokine 2/CCL2
Source:Human cells
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Supplied as a 0.2 μm filtered solution of 20mM Tris, 500mM NaCl, 10% glycerol, pH7.4 .
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source Human cells
Description Recombinant Mouse C-C motif chemokine 2 is produced by our Mammalian expression system and the target gene encoding Gln24-Asn148 is expressed with a 6His tag at the C-terminus.
Names C-C motif chemokine 2; Monocyte chemoattractant protein 1; Monocyte chemotactic protein 1; MCP-1;Platelet-derived growth factor-inducible protein JE; Small-inducible cytokine A2; Ccl2; Je; Mcp1; Scya2
Accession # P10148
Formulation Supplied as a 0.2 μm filtered solution of 20mM Tris, 500mM NaCl, 10% glycerol, pH7.4 .
Shipping The product is shipped on dry ice/ice packs.
Storage Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIK NLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVNHHHHH H
Background C-C motif chemokine 2 (CCL2) is a member of the C-C or β chemokine family. Mouse CCL2 shares 82% amino acid (aa) identity with rat CCL2 over the entire sequence, and 58%, 56%, 55%, 53% and 53% aa identity with human, equine, porcine, bovine and canine CCL2, respectively. Fibroblasts, glioma cells, smooth muscle cells, endothelial cells, lymphocytes and mononuclear phagocytes can produce CCL2 either constitutively or upon mitogenic stimulation, but monocytes and macrophages appear to be the major source. In addition to its chemotactic activity, CCL2 induces enzyme and cytokine release by monocytes, NK cells and lymphocytes, and histamine release by basophils that express its receptor, CCR2. Additionally, it promotes Th2 polarization in CD4+ T cells. CCL2-mediated recruitment of monocytes to sites of inflammation is proposed to play a role in the pathology of atherosclerosis, multiple sclerosis and allergic asthma.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese