Recombinant Mouse Interferon ζ/IFN-ζ/Limitin
| Product name: | Recombinant Mouse Interferon ζ/IFN-ζ/Limitin |
| Source: | Human Cells |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4. |
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
| UOM: | 100ug/50ug/200ug/1mg/1g |
| Source | Human Cells |
| Description | Recombinant Mouse Limitin is produced by our Mammalian expression system and the target gene encoding Leu22-Arg182 is expressed with a 6His tag at the C-terminus. |
| Names | Limitin, IFN-z, BGIF, Ifnz, interferon zeta, Lmtn, IFN-zeta |
| Accession # | Q9R1T0 |
| Formulation | Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4. |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Amino Acid Sequence |
LDSGKSGSLHLERSETARFLAELRSVPGHQCLRDRTDFPCPWKEGTNITQMTLGETTSCYSQTLR QVLHLFDTEASRAAWHERALDQLLSSLWRELQVLKSPREQGQSCPLPFALAIRTYFRGFFRYLKA KAHSACSWEIVRVQLQVDLPAFPLSARRGPRVDHHHHHH
|
| Background | Limitin, also called IFN-ζ, is a secreted interferon (IFN)-like glycoprotein. Limitin has approximately 30% sequence homology with IFN-α, IFN-β, and IFN-ω and binds to the IFN-α/β receptors. Like IFN-α and IFN-β, limitin has antiproliferative, immunomodulatory, and antiviral properties, it is unique in lacking influence on myeloid and erythroid progenitors. Similar dose requirement between limitin and IFN-α was observed for the enhancement of cytotoxic T lymphocyte activity, the augmentation of MHC class I expression, and the growth inhibition of a myelomonocytic leukemia cell line. |












