elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human T Cell Immunoglobulin and Mucin Domain-3/TIM3/HAVCR2

Recombinant Human T Cell Immunoglobulin and Mucin Domain-3/TIM3/HAVCR2 Recombinant Human T Cell Immunoglobulin and Mucin Domain-3/TIM3/HAVCR2

Instruction Manual!

Product name: Recombinant Human T Cell Immunoglobulin and Mucin Domain-3/TIM3/HAVCR2
Source:Human Cells
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
SourceHuman CellsDescriptionRecombinant Human TIM-3 is produced by our Mammalian expression system and the target gene encoding Ser22-Arg200 is expressed with a 6His tag at the C-terminus.NamesHepatitis A Virus Cellular Receptor 2, HAVcr-2, T-Cell Immunoglobulin and Mucin Domain-Containing Protein 3, TIMD-3, T-Cell Membrane Protein 3, TIM-3, HAVCR2, TIM3, TIMD3Accession #Q8TDQ0FormulationLyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.ShippingThe product is shipped at ambient temperature.
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.StorageLyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.PurityGreater than 95% as determined by reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.Amino Acid Sequence
SEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTDERDVNYWTSRYWLNG DFRKGDVSLTIENVTLADSGIYCCRIQIPGIMNDEKFNLKLVIKPAKVTPAPTLQRDFTAAFPRM LTTRGHGPAETQTLGSLPDINLTQISTLANELRDSRLANDLRDSGATIRVDHHHHHH
BackgroundT-Cell Membrane Protein 3 (TIM3) is a single-pass type I membrane protein that belongs to the TIM family of immunoglobulin superfamily. TIM3 includes a signal sequence (aa 1-21), an extracellular region (aa 22-202) with one Ig-like V-type domain, a transmembrane segment (aa 203-223), and a cytoplasmic domain (aa 224 - 301). TIM3 regulates macrophage activation, inhibits T-helper type 1 lymphocyte (Th1)-mediated auto- and alloimmune responses and promotes immunological tolerance. It may be also involved in T-cell homing and as a receptor for LGALS9.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese