elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human PD-L2/B7-DC/CD273

Recombinant Human PD-L2/B7-DC/CD273 Recombinant Human PD-L2/B7-DC/CD273

Instruction Manual!

Product name: Recombinant Human PD-L2/B7-DC/CD273
Source:Human Cells
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source Human Cells
Description Recombinant Human Programmed Cell Death 1 Ligand 2 is produced by our Mammalian expression system and the target gene encoding Leu20-Pro219 is expressed with a 6His tag at the C-terminus.
Names Programmed Cell Death 1 Ligand 2, PD-1 Ligand 2, PD-L2, PDCD1 Ligand 2, Programmed Death Ligand 2, Butyrophilin B7-DC, B7-DC, CD273, PDCD1LG2, B7DC, CD273, PDCD1L2, PDL2
Accession # Q9BQ51
Formulation Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
LFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQKVENDTSPHRERATLLEEQLPLGK ASFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKVKASYRKINTHILKVPETDEVELTCQATGYP LAEVSWPNVSVPANTSHSRTPEGLYQVTSVLRLKPPPGRNFSCVFWNTHVRELTLASIDLQSQME PRTHPVDHHHHHH
Background Programmed Cell Death 1 Ligand 2 (PDCD1LG2) is a member of the BTN/MOG family. PDCD1LG2 contains one Ig-like C2-type domain and one Ig-like V-type domain. PDCD1LG2 is highly expressed in the heart, placenta, pancreas, lung and liver; it is weakly expressed in the spleen, lymph nodes, and thymus. PDCD1LG2 is involved in the costimulatory signal, essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. PDCD1LG2 interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese