elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Leukocyte Surface Antigen CD47/IAP/OA3

Recombinant Human Leukocyte Surface Antigen CD47/IAP/OA3 Recombinant Human Leukocyte Surface Antigen CD47/IAP/OA3

Instruction Manual!

Product name: Recombinant Human Leukocyte Surface Antigen CD47/IAP/OA3
Source:Human Cells
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source Human Cells
Description Recombinant Human CD47 is produced by our Mammalian expression system and the target gene encoding Gln19-Pro139 is expressed with a Fc tag at the C-terminus.
Names Leukocyte Surface Antigen CD47, Antigenic Surface Determinant Protein OA3, Integrin-Associated Protein, IAP, Protein MER6, CD47, MER6
Accession # Q08722
Formulation Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Shipping The product is shipped at ambient temperature.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSS AKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPVDDIEGRMD EPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPRE PQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKL TVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Background CD47 is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The protein is also a receptor for the C-terminal cell-binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This protein has broad tissue distribution, and is reduced in expression on Rh erythrocytes.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese