Recombinant Human OX40 Ligand/TNFSF4/OX40L

Instruction Manual!

Product name:	Recombinant Human OX40 Ligand/TNFSF4/OX40L
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human OX40 Ligand is produced by our Mammalian expression system and the target gene encoding Gln51-Leu183 is expressed with a 6His tag at the N-terminus.
Names	Tumor necrosis factor ligand superfamily member 4,Glycoprotein Gp34,OX40 ligand,OX40L,TAX transcriptionally-activated glycoprotein 1,TNFSF4,CD252,TXGP1
Accession #	P23510
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl, pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	HHHHHHQVSHRYPRIQSIKVQFTEYKKEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYF SQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIH QNPGEFCVL
Background	Tumor necrosis factor ligand superfamily member 4(TNFSF4/OX40L) is a single-pass type II membrane protein. OX40L is the ligand for CD134 and is expressed on such cells as DC2s enabling amplification of Th2 cell differentiation. It is a cytokine that binds to TNFRSF4, Co-stimulates T-cell proliferation and cytokine production. It has been found association with systemic lupus erythematosus, No association with occurrence of atherosclerosis.