Recombinant Mouse ICOS Ligand/B7-H2/CD275

Instruction Manual!

Product name:	Recombinant Mouse ICOS Ligand/B7-H2/CD275
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Mouse ICOS Ligand is produced by our Mammalian expression system and the target gene encoding Glu47-Lys279 is expressed fused with a 6His tag at the C-terminus.
Names	B7 homolog 2; B7-H2;B7-like protein Gl50; B7RP-1LICOS; CD275; CD275 antigen; ICOS ligand; ICOSL; ICOS-L;inducible T-cell co-stimulator ligand; B7RP-1; CD275; GL50; ICOSL; ICOSLG; B7H2;B7RP1
Accession #	Q9JHJ8
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	ETEVGAMVGSNVVLSCIDPHRRHFNLSGLYVYWQIENPEVSVTYYLPYKSPGINVDSSYKNRGHL SLDSMKQGNFSLYLKNVTPQDTQEFTCRVFMNTATELVKILEEVVRLRVAANFSTPVISTSDSSN PGQERTYTCMSKNGYPEPNLYWINTTDNSLIDTALQNNTVYLNKLGLYDVISTLRLPWTSRGDVL CCVENVALHQNITSISQAESFTGNNTKNPQETHNNELKHHHHHH
Background	Mouse ICOS ligand(B7-H2) is an approximately transmembrane glycoprotein in the B7 family of immune regulatory molecules. B7-H2 is expressed on antigen presenting cells such as B cells, macrophages, monocytes, and dendritic cells. It binds to ICOS on activated T cells, leading to both positive and negative effects on immune responses including its own down-regulation. The B7-H2 interaction with ICOS is costimulatory for T cell proliferation as well as the development of B cells, plasma cells, follicular helper T cells and germinal centers. B7-H2 contributes to the development of allergic asthma by enhancing Th2 biased immune responses, limiting Th17 responses, and promoting eosinophilic infiltration into the lung. Its activation of ICOS on Treg limits pulmonary inflammation and airway hyperresponsiveness, promotes the development of inhalational tolerance, and impairs antitumor immunity. In the thyroid, B7-H2 is up-regulated on thyrocytes during inflammation and promotes their proliferation and production of thryoid hormones.