Recombinant Mouse Poliovirus Receptor/PVR/CD155

Instruction Manual!

Product name:	Recombinant Mouse Poliovirus Receptor/PVR/CD155
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Mouse Poliovirus Receptor is produced by our Mammalian expression system and the target gene encoding Asp29-Leu348 is expressed fused with a 6His tag at the C-terminus.
Names	Poliovirus receptor; CD155 antigen;Nectin-like protein 5; Nectin-2; Tage4 receptor; Pvr; PVR; Necl5; CD155;
Accession #	Q8K094
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	DIRVLVPYNSTGVLGGSTTLHCSLTSNENVTITQITWMKKDSGGSHALVAVFHPKKGPNIKEPER VKFLAAQQDLRNASLAISNLSVEDEGIYECQIATFPRGSRSTNAWLKVQARPKNTAEALEPSPTL ILQDVAKCISANGHPPGRISWPSNVNGSHREMKEPGSQPGTTTVTSYLSMVPSRQADGKNITCTV EHESLQELDQLLVTLSQPYPPENVSISGYDGNWYVGLTNLTLTCEAHSKPAPDMAGYNWSTNTGD FPNSVKRQGNMLLISTVEDGLNNTVIVCEVTNALGSGQGQVHIIVKEKPENMQQNTRLHLHHHHH H
Background	Mouse poliovirus receptor (PVR, CD155) is a type I transmembrane (TM) glycoprotein that is a member of the nectin-related family of adhesion proteins within the immunoglobulin superfamily. It binds other molecules including vitronectin, Nectin3, DNAM1, CD96, and TIGIT, but does not bind homotypically. CD155 includes a 28 aa signal sequence, a 318 aa extracellular domain (ECD) with one N-terminal V-type and two C2-type Ig-like domains, a 24 aa TM segment and a 38 aa cytoplasmic tail. Epithelial, endothelial, and many immune cells show low CD155 expression. It is up-regulated on endothelia by IFNγ, and is highly expressed on immature thymocytes, lymph node dendritic cells, and tumor cells of epithelial and neuronal origin. On migrating cells, it is concentrated at the leading edge, where it binds basement membrane vitronectin, recruits Nectin-3-expressing cells, and cooperates with PDGF and integrin αvβ3 to promote cell migration. Binding of monocyte DNAM-1 to endothelial cell CD155 promotes transendothelial migration. Enhanced CD155 expression in tumor cells contributes to loss of contact inhibition and increased migration, but also allows tumor cell recognition and killing by DNAM-1or CD96 expressing NK cells.