Recombinant Human Angiopoietin-Like Protein 8/ANGPTL8/Betatrophin
| Product name: | Recombinant Human Angiopoietin-Like Protein 8/ANGPTL8/Betatrophin |
| Source: | Human Cells |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH 8.0. |
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
| UOM: | 100ug/50ug/200ug/1mg/1g |
| Source | E.coli |
| Description | Recombinant Human Angiopoietin-like protein 8 is produced by our E.coli expression system and the target gene encoding Ala22-Ala198 is expressed with a 6His tag at the C-terminus. |
| Names | Betatrophin,Angiopoietin-like protein 8,Lipasin,Angptl8 |
| Accession # | Q6UXH0 |
| Formulation | Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl, pH 8.0. |
| Shipping |
The product is shipped at ambient temperature. |
| Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Storage |
Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
| Amino Acid Sequence |
MAPMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGR DAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFE VLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPALEHHHHHH
|
| Background | The protein specifically promotes pancreatic beta cell proliferation and beta cell mass expansion, thereby improving glucose tolerance. It promotes pancreatic beta cell proliferation without insulin resistance. Also it acts as a blood lipid regulator by regulating serum triglyceride levels and possibly by promoting ANGPTL3 cleavage. It interacts with ANGPTL3. It predominantly expressed in liver and also expressed in adipose tissues. The ability of the protein to induce pancreatic beta cell proliferation is promising in diabetes therapy. Betatrophin treatment could supply or replace insulin injections by increasing the number of insulin-producing cells in diabetes. |












