Recombinant Human BMP and Activin Membrane-Bound Inhibitor Homolog/BAMBI

Instruction Manual!

Product name:	Recombinant Human BMP and Activin Membrane-Bound Inhibitor Homolog/BAMBI
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human BAMBI is produced by our Mammalian expression system and the target gene encoding Val21-Ala152 is expressed with a 6His tag at the C-terminus.
Names	BMP and Activin Membrane-Bound Inhibitor Homolog, Non-Metastatic Gene A Protein, Putative Transmembrane Protein NMA, BAMBI, NMA
Accession #	Q13145
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	VLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNSNSPLTHGCLDSLASTTDICQAKQA RNHSGTTIPTLECCHEDMCNYRGLHDVLSPPRGEASGQGNRYQHDGSRNLITKVQELTSSKELWF RAVDHHHHHH
Background	BMP and Activin Membrane-Bound Inhibitor Homolog (BAMBI) is a single-pass type I membrane protein that belongs to the BAMBI family. BAMBI is highly expression in kidney medulla, placenta and spleen. BAMBI is induced by BMP signaling through the evolutionary conserved BMP-responsive elements in its promoter. BAMBI plays important roles in signal transduction in many developmental and pathological processes. BAMBI transcription is activated by Wnt/beta-catenin signaling then its expression is aberrantly elevated in most colorectal carcinomas. BAMBI stably associates with TGF-β-family receptors and inhibits BMP and activin as well as TGF-β signalling. BAMBI negatively regulates TGF-β-family signalling by a regulatory mechanism involving the interaction of signalling receptors with a pseudoreceptor.