Recombinant Human CD44/MIC4

Instruction Manual!

Product name:	Recombinant Human CD44/MIC4
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human CD44 is produced by our Mammalian expression system and the target gene encoding Gln21-Pro220 is expressed with a 6His tag at the C-terminus.
Names	CD44 Antigen, CDw44, Epican, Extracellular Matrix Receptor III, ECMR-III, GP90 Lymphocyte Homing/Adhesion Receptor, HUTCH-I, Heparan Sulfate Proteoglycan, Hermes Antigen, Hyaluronate Receptor, Phagocytic Glycoprotein 1, PGP-1, Phagocytic Glycoprotein I, PGP-I, CD44, LHR, MDU2, MDU3, MIC4
Accession #	P16070
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	QIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGH VVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNR DGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERSSTSGGYIFYTFSTVHPIPDEDSPWITDS TDRIPVDHHHHHH
Background	CD44 is a cell-surface receptor for hyaluronic acid and also interacts with other ligands, such as osteopontin, collagens, and matrix metalloproteinases. A large number of CD44 isoforms can be generated by the insertion of different combinations of at least nine exons. Increased CD44 antigen is associated with relapses in non-small cell lung cancers. Furthermore, an increasing quantity of evidence suggests that CD44 has various functions related to inflammatory disease. CD44 deficiency induces severe liver injury. CD44-hyaluronate mediates in lymphocyte T and monocyte adhesion to the endothelium, stimulates proinflammatory cytokine release from macrophages and participates in dedifferentiation phenotype of smooth muscle cells from contractile state to synthetic one.