Recombinant Human High Mobility Group Protein B1/HMGB1

Instruction Manual!

Product name:	Recombinant Human High Mobility Group Protein B1/HMGB1
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM EDTA, 1mM DTT, 10% Glycerol, pH 7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human High Mobility Group Protein B1 is produced by our Mammalian expression system and the target gene encoding Gly2-Glu215 is expressed with a 6His tag at the C-terminus.
Names	High Mobility Group Protein B1, High Mobility Group Protein 1, HMG-1, HMGB1, HMG1
Accession #	P09429
Formulation	Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 1mM EDTA, 1mM DTT, 10% Glycerol, pH 7.4.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKA DKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGE MWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEED EEEEEDEEDEDEEEDDDDEVDHHHHHH
Background	High mobility group protein B1 is a member of the HMGB family consisting of three members, HMGB1, HMGB2 and HMGB3.It Contains 2 HMG box DNA-binding domains entitled box A and box B and It is a highly negative-charged C terminus. As a nuclear protein, HMGB1 stabilizes nucleosomes and allows bending of DNA that facilitates gene transcription which is essential for individual survival. Meanwhile, it is revealed that HMGB1 can also act as a cytokine extracellularlly and regulates monocyte, T cell, dendritic cell activities in inflammatory responses.