Recombinant Human Transforming Growth Factor α/TGFα

Instruction Manual!

Product name:	Recombinant Human Transforming Growth Factor α/TGFα
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 10mM Acetic Acid .
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Transforming Growth Factor alpha is produced by our E.coli expression system and the target gene encoding Val41-Val90 is expressed.
Names	Protransforming Growth Factor Alpha, TGF-Alpha, EGF-Like TGF, ETGF, TGF Type 1, TGFA
Accession #	P01135
Formulation	Lyophilized from a 0.2 μm filtered solution of 10mM Acetic Acid .
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	VSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAV
Background	Transforming Growth Factor α (TGF-α) belongs to the EGF family of cytokines. It is a mitogenic polypeptide and secreted protein, which is expressed by monocytes, keratinocytes, and various tumor cells. TGFα contains two chains, protransforming growth factor α and transforming growth factor α. It can bind to the EGF receptor that synergistically with TGFβ to stimulate anchorage-independent cell proliferation and produce a mitogenic response. TGFα interacts with the PDZ domains of MAGI3, SDCBP and SNTA1. The interaction with SDCBP is required for the targeting to the cell surface.