Recombinant Human Secreted Frizzled-Related Protein 2/sFRP-2/SARP1

Instruction Manual!

Product name:	Recombinant Human Secreted Frizzled-Related Protein 2/sFRP-2/SARP1
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Secreted Frizzled-Related Protein 2 is produced by our Mammalian expression system and the target gene encoding Leu25-Cys295 is expressed with a 6His tag at the C-terminus.
Names	Secreted Frizzled-Related Protein 2, FRP-2, sFRP-2, Secreted Apoptosis-Related Protein 1, SARP-1, SFRP2, FRP2, SARP1
Accession #	Q96HF1
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	LFLFGQPDFSYKRSNCKPIPVNLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHP DTKKFLCSLFAPVCLDDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIP LASSDHLLPATEEAPKVCEACKNKNDDDNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSK TIYKLNGVSERDLKKSVLWLKDSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFK RISRSIRKLQCVDHHHHHH
Background	Secreted Frizzled-Related Protein 2 (sFRP2) belongs to the secreted frizzled-related protein (sFRP) family. sFRP2 is highly expressed in adipose tissue, small intestine and colon. SFRP2 Contains one NTR domain and one FZ (frizzled) domain which is involved in binding with Wnt ligands.Secreted frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. sFRP2 may be important for eye retinal development and for myogenesis.