Recombinant Human Carboxypeptidase B/CPB1

Instruction Manual!

Product name:	Recombinant Human Carboxypeptidase B/CPB1
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM MES, 150mM NaCl, pH 5.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Carboxypeptidase B is produced by our Mammalian expression system and the target gene encoding His16-Tyr417 is expressed with a 6His tag at the C-terminus.
Names	Carboxypeptidase B, Pancreas-Specific Protein, PASP, CPB1, CPB, PCPB
Accession #	P15086
Formulation	Supplied as a 0.2 μm filtered solution of 20mM MES, 150mM NaCl, pH 5.5.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	HHGGEHFEGEKVFRVNVEDENHINIIRELASTTQIDFWKPDSVTQIKPHSTVDFRVKAEDTVTVE NVLKQNELQYKVLISNLRNVVEAQFDSRVRATGHSYEKYNKWETIEAWTQQVATENPALISRSVI GTTFEGRAIYLLKVGKAGQNKPAIFMDCGFHAREWISPAFCQWFVREAVRTYGREIQVTELLDKL DFYVLPVLNIDGYIYTWTKSRFWRKTRSTHTGSSCIGTDPNRNFDAGWCEIGASRNPCDETYCGP AAESEKETKALADFIRNKLSSIKAYLTIHSYSQMMIYPYSYAYKLGENNAELNALAKATVKELAS LHGTKYTYGPGATTIYPAAGGSDDWAYDQGIRYSFTFELRDTGRYGFLLPESQIRATCEETFLAI KYVASYVLEHLYVDHHHHHH
Background	Carboxypeptidase B1 is an exopeptidase which specifically cleaves the C-terminal Arg and Lys residues with a preference for Arg. Expressed mainly in pancreas, CPB1 is a useful serum marker for acute pancreatitis and pancreatic graft rejection.Human CPB1 consists of a signal peptide, a pro region, and a mature chain. The purified rhCPB1 corresponds to the pro form, which can be activated by trypsin, the only pancreatic protease capable of generating active enzyme from the zymogen in vitro.