Recombinant Human Maleylacetoacetate Isomerase/MAA/GSTZ1

Instruction Manual!

Product name:	Recombinant Human Maleylacetoacetate Isomerase/MAA/GSTZ1
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 50mM TrisHCl, 1mM DTT, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Glutathione S-Transferase Zeta 1 is produced by our E.coli expression system and the target gene encoding Met1-Ala216 is expressed with a 6His tag at the C-terminus.
Names	Maleylacetoacetate Isomerase, MAAI, GSTZ1-1, Glutathione S-Transferase Zeta 1, GSTZ1
Accession #	O43708
Formulation	Supplied as a 0.2 μm filtered solution of 50mM TrisHCl, 1mM DTT, pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKID GITIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTW AQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLV LEAFQVSHPCRQPDTPTELRALEHHHHHH
Background	Maleylacetoacetate Isomerase (MAAI) belongs to the Glutathione S-Transferase super-family. MAAI encodes multifunctional enzymes in the detoxification of electrophilic molecules by conjugation with glutathione, for example, mutagens, carcinogens and several therapeutic drugs. MAAI is a bifunctional protein with low glutathione peroxidase activity with T-butyl and cumene hydroperoxides. MAAI can catalyze the glutathione dependent oxygenation of dichloroacetic acid to glyoxylic acid. But it has minimal glutathione-conjugating activity with 7-chloro-4-nitrobenz-2-oxa-1, ethacrynic acid 3-diazole and maleylacetoacetate isomerase activity.