Recombinant Human Alcohol Dehydrogenase Class 4 Mu/ADH7
| Product name: | Recombinant Human Alcohol Dehydrogenase Class 4 Mu/ADH7 | 
| Source: | Human Cells | 
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. | 
| Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of PBS,PH7.4. | 
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. | 
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. | 
| UOM: | 100ug/50ug/200ug/1mg/1g | 
| Source | Human Cells | 
| Description | Recombinant Human ADH7 is produced by our Mammalian expression system and the target gene encoding Met1-Phe386 is expressed with a 6His tag at the C-terminus. | 
| Names | Alcohol Dehydrogenase Class 4 Mu/Sigma Chain, Alcohol Dehydrogenase Class IV Mu/Sigma Chain, Gastric Alcohol Dehydrogenase, Retinol Dehydrogenase, ADH7 | 
| Accession # | P40394 | 
| Formulation | Lyophilized from a 0.2 μm filtered solution of PBS,PH7.4. | 
| Shipping | The product is shipped at ambient temperature. | 
| Reconstitution | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. | 
| Storage | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. | 
| Purity | Greater than 95% as determined by reducing SDS-PAGE. | 
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. | 
| Amino Acid Sequence | 
					MFAEIQIQDKDRMGTAGKVIKCKAAVLWEQKQPFSIEEIEVAPPKTKEVRIKILATGICRTDDHV IKGTMVSKFPVIVGHEATGIVESIGEGVTTVKPGDKVIPLFLPQCRECNACRNPDGNLCIRSDIT GRGVLADGTTRFTCKGKPVHHFMNTSTFTEYTVVDESSVAKIDDAAPPEKVCLIGCGFSTGYGAA VKTGKVKPGSTCVVFGLGGVGLSVIMGCKSAGASRIIGIDLNKDKFEKAMAVGATECISPKDSTK PISEVLSEMTGNNVGYTFEVIGHLETMIDALASCHMNYGTSVVVGVPPSAKMLTYDPMLLFTGRT WKGCVFGGLKSRDDVPKLVTEFLAKKFDLDQLITHVLPFKKISEGFELLNSGQSIRTVLTFVDHH HHHH
				 | 
| Background | Alcohol dehydrogenase class 4 mu/sigma chain (ADH7) is a cytoplasm enzyme which is a member of the alcohol dehydrogenase family. The expression of this gene makes it much more abundant in the stomach than the liver, thus it differs from the other known gene family members. ADH7 may participate in the synthesis of retinoic acid, a hormone important for cellular differentiation. Medium-chain (octanol) and aromatic (m-nitrobenzaldehyde) compounds are the best substrates. Ethanol is not a good substrate but at the high ethanol concentrations reached in the digestive tract, it plays a role in the ethanol oxidation and contributes to the first pass ethanol metabolism. | 


 


 
              








