Recombinant Human Trans-2-Enoyl-CoA Reductase Mitochondrial/MECR
| Product name: | Recombinant Human Trans-2-Enoyl-CoA Reductase Mitochondrial/MECR | 
| Source: | Human Cells | 
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. | 
| Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4. | 
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. | 
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. | 
| UOM: | 100ug/50ug/200ug/1mg/1g | 
| Source | Human Cells | 
| Description | Recombinant Human Trans-2-Enoyl-CoA Reductase is produced by our Mammalian expression system and the target gene encoding Pro54-Met373 is expressed with a 6His tag at the C-terminus. | 
| Names | Trans-2-Enoyl-CoA Reductase Mitochondrial, Nuclear Receptor-Binding Factor 1, HsNrbf-1NRBF-1, MECR, NBRF1 | 
| Accession # | Q9BV79 | 
| Formulation | Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4. | 
| Shipping | The product is shipped at ambient temperature. | 
| Reconstitution | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. | 
| Storage | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. | 
| Purity | Greater than 95% as determined by reducing SDS-PAGE. | 
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. | 
| Amino Acid Sequence | 
					PAKVVELKNLELAAVRGSDVRVKMLAAPINPSDINMIQGNYGLLPELPAVGGNEGVAQVVAVGSN VTGLKPGDWVIPANAGLGTWRTEAVFSEEALIQVPSDIPLQSAATLGVNPCTAYRMLMDFEQLQP GDSVIQNASNSGVGQAVIQIAAALGLRTINVVRDRPDIQKLSDRLKSLGAEHVITEEELRRPEMK NFFKDMPQPRLALNCVGGKSSTELLRQLARGGTMVTYGGMAKQPVVASVSLLIFKDLKLRGFWLS QWKKDHSPDQFKELILTLCDLIRRGQLTAPACSQVPLQDYQSALEASMKPFISSKQILTMVDHHH HHH
				 | 
| Background | Trans-2-Enoyl-CoA Reductase Mitochondrial (MECR) belongs to the zinc-containing alcohol dehydrogenase family. MECR localizes to the mitochondrion. It is highly expressed in skeletal and heart muscle and expressed at lower levels in the placenta, liver, kidney and pancreas, with weakly or no expression in the lung. MECR exists as a homodimer, which catalyzes the reduction of trans-2-enoyl-CoA to acyl-CoA with chain length from C6 to C16 in an NADPH-dependent manner with preference to medium chain length substrate. MECR may take part in the mitochondrial synthesis of fatty acids. | 


 


 
              








