Recombinant Human Phosphatidylinositol 4-Kinase β/PI4KB
| Product name: | Recombinant Human Phosphatidylinositol 4-Kinase β/PI4KB | 
| Source: | Human Cells | 
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. | 
| Buffer Formulation: | Supplied as a 0.2 μm filtered solution of 25mM Tris.HCl,pH7.3,100mM glycine,10%glycerol. | 
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. | 
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. | 
| UOM: | 100ug/50ug/200ug/1mg/1g | 
| Source | Human Cells | 
| Description | Recombinant Human PI4KB is produced by our Mammalian expression system and the target gene encoding Met1-Met801 is expressed with a 6His tag at the C-terminus. | 
| Names | Phosphatidylinositol 4-Kinase Beta, PI4K-Beta, PI4KBeta, PtdIns 4-Kinase Beta, NPIK, PI4K92, PI4KB, PIK4CB | 
| Accession # | Q9UBF8-2 | 
| Formulation | Supplied as a 0.2 μm filtered solution of 25mM Tris.HCl,pH7.3,100mM glycine,10%glycerol. | 
| Shipping | The product is shipped on dry ice/ice packs. | 
| Storage | Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. | 
| Purity | Greater than 95% as determined by reducing SDS-PAGE. | 
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. | 
| Amino Acid Sequence | 
					MGDTVVEPAPLKPTSEPTSGPPGNNGGSLLSVITEGVGELSVIDPEVAQKACQEVLEKVKLLHGG VAVSSRGTPLELVNGDGVDSEIRCLDDPPAQIREEEDEMGAAVASGTAKGARRRRQNNSAKQSWL LRLFESKLFDISMAISYLYNSKEPGVQAYIGNRLFCFRNEDVDFYLPQLLNMYIHMDEDVGDAIK PYIVHRCRQSINFSLQCALLLGAYSSDMHISTQRHSRGTKLRKLILSDELKPAHRKRELPSLSPA PDTGLSPSKRTHQRSKSDATASISLSSNLKRTASNPKVENEDEPVRLAPEREFIKSLMAIGKRLA TLPTKEQKTQRLISELSLLNHKLPARVWLPTAGFDHHVVRVPHTQAVVLNSKDKAPYLIYVEVLE CENFDTTSVPARIPENRIRSTRSVENLPECGITHEQRAGSFSTVPNYDNDDEAWSVDDIGELQVE LPEVHTNSCDNISQFSVDSITSQESKEPVFIAAGDIRRRLSEQLAHTPTAFKRDPEDPSAVALKE PWQEKVRRIREGSPYGHLPNWRLLSVIVKCGDDLRQELLAFQVLKQLQSIWEQERVPLWIKPYKI LVISADSGMIEPVVNAVSIHQVKKQSQLSLLDYFLQEHGSYTTEAFLSAQRNFVQSCAGYCLVCY LLQVKDRHNGNILLDAEGHIIHIDFGFILSSSPRNLGFETSAFKLTTEFVDVMGGLDGDMFNYYK MLMLQGLIAARKHMDKVVQIVEIMQQGSQLPCFHGSSTIRNLKERFHMSMTEEQLQLLVEQMVDG SMRSITTKLYDGFQYLTNGIMVDHHHHHH
				 | 
| Background | Phosphatidylinositol 4-Kinase β (PI4KB) belongs to the PI3/PI4-kinase family and Type III PI4K subfamily. PI4KB contains one PI3K/PI4K domain and one PIK helical domain. It is highly expressed in heart, skeletal muscle, pancreas, testis and ovary,; it is lowly expressed in liver tissue. PI4KB kinase activity can be inhibited by wortmannin, and increased by interacting with NCS1/FREQ. PI4KB phosphorylates phosphatidylinositol (PI) in the first committed step in the production of the second messenger inositol-1,4,5,-trisphosphate (PIP). In addition, PI4KB may regulate Golgi disintegration/reorganization during mitosis. | 


 


 
              








