Recombinant Human Group XVI Phospholipase A1/A2/PLA2G16

Instruction Manual!

Product name:	Recombinant Human Group XVI Phospholipase A1/A2/PLA2G16
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human PLA2G16 is produced by our E.coli expression system and the target gene encoding Asp12-Asp132 is expressed with a 6His tag at the N-terminus.
Names	Group XVI Phospholipase A1/A2, Adipose-Specific Phospholipase A2, AdPLA, H-Rev 107 Protein Homolog, HRAS-Like Suppressor 1, HRAS-Like Suppressor 3, HRSL3, HREV107-1, HREV107-3, Renal Carcinoma Antigen NY-REN-65, PLA2G16, HRASLS3, HREV107
Accession #	P53816
Formulation	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Biological Activity	IN STOCK
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALT DKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNEL RYGVARSDQVRD
Background	Group XVI Phospholipase A1/A2 (PLA2G16) belongs to the H-rev 107 family. PLA2G16 is expressed in a number of human tumors including ovarian carcinomas, lung carcinomas. PLA2G16 is involved in the regulation of differentiation and survival. PLA2G16 regulates adipocyte lipolysis and release of fatty acids through a G-protein coupled pathway involving prostaglandin and EP3. It has also been reported to play a crucial role in the development of obesity in mouse models.