Recombinant Human Inosine-5'-Monophosphate Dehydrogenase 2/IMPDH2
| Product name: | Recombinant Human Inosine-5'-Monophosphate Dehydrogenase 2/IMPDH2 | 
| Source: | E. coli | 
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. | 
| Buffer Formulation: | Supplied as a 0.2 μm filtered solution of 20mM Tris 150mM NaCl pH 8.0 . | 
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. | 
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. | 
| UOM: | 100ug/50ug/200ug/1mg/1g | 
| Source | E. coli | 
| Description | Recombinant Human IMPDH2 is produced by our E.coli expression system and the target gene encoding Met1-Phe514 is expressed with a 6His tag at the N-terminus. | 
| Names | Inosine-5'-monophosphate dehydrogenase 2, IMPDH2, IMP dehydrogenase 2, IMPD 2, IMPDH 2, IMPDH-II, IMPD2. | 
| Accession # | P12268 | 
| Formulation | Supplied as a 0.2 μm filtered solution of 20mM Tris 150mM NaCl pH 8.0 . | 
| Shipping | The product is shipped on dry ice/ice packs. | 
| Storage | Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. | 
| Purity | Greater than 95% as determined by reducing SDS-PAGE. | 
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. | 
| Amino Acid Sequence | 
					MGSSHHHHHHSSGLVPRGSHMADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFT ADQVDLTSALTKKITLKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKY EQGFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDCFL EEIMTKREDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKDA KKQLLCGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNSIFQINMIKYIKDKYPNLQVIGGNVV TAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVPVIADGGIQNV GHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAMDKHLSSQNRYFSEAD KIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVE GGVHSLHSYEKRLF
				 | 
| Background | IMPDH2 is a cytosolic enzyme which belongs to the IMPDH/GMPR family. IMPDH2 catalyzes the NAD-dependent oxidation of inosine-5'-monophosphate into xanthine-5'-monophosphate, which is then converted into guanosine-5'- monophosphate. IMPDH2 is consequently involved in maintaining cellular guanine deoxy- and ribonucleotide pools required for DNA and RNA synthesis. In addition, IMPDH1 and IMPDH2 are targets for the important immunosuppressive drug, mycophenolic acid (MPA). | 


 


 
              








