elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Inosine-5'-Monophosphate Dehydrogenase 2/IMPDH2

Recombinant Human Inosine-5'-Monophosphate Dehydrogenase 2/IMPDH2 Recombinant Human Inosine-5'-Monophosphate Dehydrogenase 2/IMPDH2

Instruction Manual!

Product name: Recombinant Human Inosine-5'-Monophosphate Dehydrogenase 2/IMPDH2
Source:E. coli
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Supplied as a 0.2 μm filtered solution of 20mM Tris 150mM NaCl pH 8.0 .
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source E. coli
Description Recombinant Human IMPDH2 is produced by our E.coli expression system and the target gene encoding Met1-Phe514 is expressed with a 6His tag at the N-terminus.
Names Inosine-5'-monophosphate dehydrogenase 2, IMPDH2, IMP dehydrogenase 2, IMPD 2, IMPDH 2, IMPDH-II, IMPD2.
Accession # P12268
Formulation Supplied as a 0.2 μm filtered solution of 20mM Tris 150mM NaCl pH 8.0 .
Shipping The product is shipped on dry ice/ice packs.
Storage Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
MGSSHHHHHHSSGLVPRGSHMADYLISGGTSYVPDDGLTAQQLFNCGDGLTYNDFLILPGYIDFT ADQVDLTSALTKKITLKTPLVSSPMDTVTEAGMAIAMALTGGIGFIHHNCTPEFQANEVRKVKKY EQGFITDPVVLSPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDCFL EEIMTKREDLVVAPAGITLKEANEILQRSKKGKLPIVNEDDELVAIIARTDLKKNRDYPLASKDA KKQLLCGAAIGTHEDDKYRLDLLAQAGVDVVVLDSSQGNSIFQINMIKYIKDKYPNLQVIGGNVV TAAQAKNLIDAGVDALRVGMGSGSICITQEVLACGRPQATAVYKVSEYARRFGVPVIADGGIQNV GHIAKALALGASTVMMGSLLAATTEAPGEYFFSDGIRLKKYRGMGSLDAMDKHLSSQNRYFSEAD KIKVAQGVSGAVQDKGSIHKFVPYLIAGIQHSCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVE GGVHSLHSYEKRLF
Background IMPDH2 is a cytosolic enzyme which belongs to the IMPDH/GMPR family. IMPDH2 catalyzes the NAD-dependent oxidation of inosine-5'-monophosphate into xanthine-5'-monophosphate, which is then converted into guanosine-5'- monophosphate. IMPDH2 is consequently involved in maintaining cellular guanine deoxy- and ribonucleotide pools required for DNA and RNA synthesis. In addition, IMPDH1 and IMPDH2 are targets for the important immunosuppressive drug, mycophenolic acid (MPA).

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese