elisa kit elisa kits logo

Tel:631-424-0089
Fax:631-424-0095
Email: info@immunoclone.com

Home>>Products >>  Proteins

Recombinant Human Sterol O-Acyltransferase 2/SOAT2/ACAT2

Recombinant Human Sterol O-Acyltransferase 2/SOAT2/ACAT2 Recombinant Human Sterol O-Acyltransferase 2/SOAT2/ACAT2

Instruction Manual!

Product name: Recombinant Human Sterol O-Acyltransferase 2/SOAT2/ACAT2
Source:E. coli
Purity:Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Applications:Applications:SDS-PAGE; WB; ELISA; IP.
Storage:Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:100ug/50ug/200ug/1mg/1g
Source E. coli
Description Recombinant Human Sterol O-acyltransferase 2 is produced by our E.coli expression system and the target gene encoding Met1-Glu397 is expressed with a Trx, 6His tag at the N-terminus.
Names Acetyl-CoA acetyltransferase cytosolic, Acetyl-CoA transferase-like protein, Cytosolic acetoacetyl-CoA thiolase, ACTL, ACAT2
Accession # O75908
Formulation Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4.
Shipping The product is shipped on dry ice/ice packs.
Storage Store at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.
Purity Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence
MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNP GTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRG SGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSMNAGSDPVVIVSAARTIIGSFNGALAAVPV QDLGSTVIKEVLKRATVAPEDVSEVIFGHVLAAGCGQNPVRQASVGAGIPYSVPAWSCQMICGSG LKAVCLAVQSIGIGDSSIVVAGGMENMSKAPHLAYLRTGVKIGEMPLTDSILCDGLTDAFHNCHM GITAENVAKKWQVSREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRRGLIEVKTDEFPRHG SNIEAMSKLKPYFLTDGTGTVTPANASGINDGAAAVVLMKKSEADKRGLTPLARIVSWSQVGVEP SIMGIGPIPAIKQAVTKAGWSLEDVDIFEINEAFAAVSAAIVKELGLNPEKVNIEGGAIALGHPL GASGCRILVTLLHTLERMGRSRGVAALCIGGGMGIAMCVQRE
Background ACAT2 is a cytoplasmic enzyme which belongs to the thiolase family. ACAT2 takes part in lipid metabolism, lipoprotein assembly, catalyzing cholesterol esterification in mammalian cells. It is responsible for the synthesis of cholesteryl esters which are part of lipoproteins containing apoB. ACAT2 deficiency contributes to severe mental retardation and hypotonus.

Copyright @ USA Immuno Clone Co., Ltd(I&C) All Rights Reserved Language:Chinese