Recombinant Human Sterol O-Acyltransferase 2/SOAT2/ACAT2
| Product name: | Recombinant Human Sterol O-Acyltransferase 2/SOAT2/ACAT2 | 
| Source: | E. coli | 
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. | 
| Buffer Formulation: | Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4. | 
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. | 
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. | 
| UOM: | 100ug/50ug/200ug/1mg/1g | 
| Source | E. coli | 
| Description | Recombinant Human Sterol O-acyltransferase 2 is produced by our E.coli expression system and the target gene encoding Met1-Glu397 is expressed with a Trx, 6His tag at the N-terminus. | 
| Names | Acetyl-CoA acetyltransferase cytosolic, Acetyl-CoA transferase-like protein, Cytosolic acetoacetyl-CoA thiolase, ACTL, ACAT2 | 
| Accession # | O75908 | 
| Formulation | Supplied as a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.4. | 
| Shipping | The product is shipped on dry ice/ice packs. | 
| Storage | Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. | 
| Purity | Greater than 95% as determined by reducing SDS-PAGE. | 
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. | 
| Amino Acid Sequence | 
					MSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNP GTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGSGHMHHHHHHSSGLVPRG SGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSMNAGSDPVVIVSAARTIIGSFNGALAAVPV QDLGSTVIKEVLKRATVAPEDVSEVIFGHVLAAGCGQNPVRQASVGAGIPYSVPAWSCQMICGSG LKAVCLAVQSIGIGDSSIVVAGGMENMSKAPHLAYLRTGVKIGEMPLTDSILCDGLTDAFHNCHM GITAENVAKKWQVSREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRRGLIEVKTDEFPRHG SNIEAMSKLKPYFLTDGTGTVTPANASGINDGAAAVVLMKKSEADKRGLTPLARIVSWSQVGVEP SIMGIGPIPAIKQAVTKAGWSLEDVDIFEINEAFAAVSAAIVKELGLNPEKVNIEGGAIALGHPL GASGCRILVTLLHTLERMGRSRGVAALCIGGGMGIAMCVQRE
				 | 
| Background | ACAT2 is a cytoplasmic enzyme which belongs to the thiolase family. ACAT2 takes part in lipid metabolism, lipoprotein assembly, catalyzing cholesterol esterification in mammalian cells. It is responsible for the synthesis of cholesteryl esters which are part of lipoproteins containing apoB. ACAT2 deficiency contributes to severe mental retardation and hypotonus. | 


 


 
              








