Recombinant Human Pyruvate Kinase M2/PKM2
| Product name: | Recombinant Human Pyruvate Kinase M2/PKM2 | 
| Source: | E. coli | 
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. | 
| Buffer Formulation: | Supplied as a 0.2 μm filtered solution of PBS, pH7.0, 10% glycerol. | 
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. | 
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. | 
| UOM: | 100ug/50ug/200ug/1mg/1g | 
SourceE. coliDescriptionRecombinant Human Pyruvate kinase M2 is produced by our E.coli expression system and the target gene encoding Ser2-Pro531 is expressed with a 6His tag at the N-terminus.NamesPyruvate kinase PKM, CTHBP, OIP-3, THBP1Accession #P14618FormulationSupplied as a 0.2 μm filtered solution of PBS, pH7.0, 10% glycerol.ShippingThe product is shipped on dry ice/ice packs.
StorageStore at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.PurityGreater than 95% as determined by reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.Amino Acid Sequence
StorageStore at < -20°C, stable for 6 months after receipt.
Please minimize freeze-thaw cycles.PurityGreater than 95% as determined by reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.Amino Acid Sequence
	MGSSHHHHHHSSGLVPRGSHMSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNT GIICTIGPASRSVETLKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATESFASDPILYRPVAV ALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICKVVEVGSKIY VDDGLISLQVKQKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDIQDLKFGVEQDVDMV FASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEASDGIMVARGDLGIEIPAEK VFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGSDVANAVLDGADCIMLSGETAKGDY PLEAVRMQHLIAREAEAAIYHLQLFEELRRLAPITSDPTEATAVGAVEASFKCCSGAIIVLTKSG RSAHQVARYRPRAPIIAVTRNPQTARQAHLYRGIFPVLCKDPVQEAWAEDVDLRVNFAMNVGKAR GFFKKGDVVIVLTGWRPGSGFTNTMRVVPVP
BackgroundPyruvate kinase isoform M2 (PKM2) is a member of the pyruvate kinase (PK) family, a pivotal glycolytic enzyme that is consistently changed during tumorigenesis. PKM2 is expressed in some differentiated tissues, such as lung, fat tissue, retina, and pancreatic islets. As the rate-controlling enzyme in glycolysis, PKM2, has also been found to be expressed in embryonic, proliferating, and tumor cells, and it has been considered to be crucial for the metabolism and growth of tumor cells. Recent studies have shown that PKM2 promotes cell proliferation and suppresses cell apoptosis in various tumors. In addition, it has been reported that the PKM2 knockdown affects the Akt and ERK protein kinases.

 


 
              








