Recombinant E. coli Malate Dehydrogenase/MDH

Instruction Manual!

Product name:	Recombinant E. coli Malate Dehydrogenase/MDH
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 50mM PB,50%Glycerol,pH7.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant E.coli Malate Dehydrogenase is produced by our E.coli expression system and the target gene encoding Met1-Lys312 is expressed with a 6His tag at the N-terminus.
Names	Malate dehydrogenase,mdh
Accession #	P61889
Formulation	Supplied as a 0.2 μm filtered solution of 50mM PB,50%Glycerol,pH7.5.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMKVAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVD LSHIPTAVKIKGFSGEDATPALEGADVVLISAGVRRKPGMDRSDLFNVNAGIVKNLVQQVAKTCP KACIGIITNPVNTTVAIAAEVLKKAGVYDKNKLLGVTTLDIIRSNTFVAELKGKQPGEVEVPVIG GHSGVTILPLLSQVPGVSFTEQEVADLTKRIQNAGTEVVEAKAGGGSATLSMGQAAARFGLSLVR ALQGEQGVVECAYVEGDGQYARFFSQPLLLGKNGVEERKSIGTLSAFEQNALEGMLDTLKKDIAL GQEFVNK
Background	Escherichia coli MDH, also known as Malate dehydrogenase, is a group of multimeric enzymes consisting of identical subunits usually organized as either dimer or tetramers with subunit molecular weights of 30-35 kDa. Its major function is to catalyze the NAD / NADH-dependent interconversion of the substrates malate and oxaloacetate. This reaction plays a key part in the malate / aspartate shuttle across the mitochondrial membrane, and in the tricarboxylic acid cycle within the mitochondrial matrix.MDH is synthesized in several organisms including archaea, eubacteria, fungi, plant and mammals. The enzymes share a common catalytic mechanism and their kinetic properties are similar, which demonstrates a high degree of structural similarity. The three-dimensional structures and elements essential for catalysis are conserved between mitochondrial and cytoplasmic forms of MDH in eukaryotic cells even though these isoenzymes are only marginally related at the level of primary structure.