| ELISA kit |
| Clinical diagnosis |
| Trfia |
| ANTIBODIES |
| CLIA kits |
| Proteins |
| New Products |
| > Human |
| > Canine |
| > Bovine |
| > Equine |
| > Fish |
| > Mouse |
| > Rat |
| > Chicken |
| > Porcine |
| > Rabbit |
| > Goat |
| > Simian |
| > General |
| > Cavia |
| > Caprine |
| > Sheep |
| > Cattle |
Recombinant Mouse Carboxypeptidase M/CPM
Instruction Manual!
| Product name: | Recombinant Mouse Carboxypeptidase M/CPM |
| Source: | Human Cells |
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. |
| Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4. |
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. |
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. |
| UOM: | 100ug/50ug/200ug/1mg/1g |
SourceHuman CellsDescriptionRecombinant Mouse carboxypeptidase M is produced by our Mammalian expression system and the target gene encoding Leu18-Ser423 is expressed with a 6His tag at the C-terminus.NamesCarboxypeptidase M,CPMAccession #Q80V42FormulationLyophilized from a 0.2 μm filtered solution of PBS,pH7.4.ShippingThe product is shipped at ambient temperature.
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.StorageLyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.PurityGreater than 95% as determined by reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.Amino Acid Sequence
ReconstitutionAlways centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 μg/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.StorageLyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7°C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20°C for 3 months.PurityGreater than 95% as determined by reducing SDS-PAGE.
EndotoxinLess than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.Amino Acid Sequence
LDFRYHHQEGMEAFLKSVAQNYSSITHLHSIGKSVRGRNLWVLVVGQTPKEHRVGIPEFKYVANM HGDETVGRELLLHLIDYLVSSYRKDPEITHLIDSTRIHIMPSMNPDGFEAVQKPDCYYSNGRENY NNYDLNRNFPDAFENNNVTKQPETLAIMEWLKTETFVLSANLHGGALVASYPFDNGVQATGTLLS RSLTPDDDVFQHLAYTYASRNPNMTKGDQCKNKRNFPNGIINGYSWYPLQGGMQDYNYIWAQCFE ITLELSCCKYPREEKLPLFWNDNKASLIEYIKQVHLGVKGQVFDQSGAPLPNVIVEVQDRKHICP FRTNKLGEYYLLLLPGSYVINVTVPGHDSYLTKLTIPGKSQPFSALKKDFHLPLRWQPDSISVSN PSCPMIPLYKFMPSHSVDHHHHHH
BackgroundCarboxypeptidase M (CPM) belongs to the peptidase M14 family, and exists in cell membrane. The protein binds 1 zinc ion per subunit, and cleavage of C-terminal arginine or lysine residues from polypeptides. CPM specifically removes C-terminal basic residues (Arg or Lys) from peptides and proteins. It is believed to play important roles in the control of peptide hormone and growth factor activity at the cell surface, and in the membrane-localized degradation of extracellular proteins.
