Recombinant Mouse Carboxylesterase 3/CES3
| Product name: | Recombinant Mouse Carboxylesterase 3/CES3 | 
| Source: | Human Cells | 
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. | 
| Buffer Formulation: | Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,pH8.0. | 
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. | 
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. | 
| UOM: | 100ug/50ug/200ug/1mg/1g | 
| Source | Human Cells | 
| Description | Recombinant Mouse Carboxylesterase 3 is produced by our Mammalian expression system and the target gene encoding Tyr19-Glu561 is expressed with a 6His tag at the C-terminus. | 
| Names | CES3, carboxylesterase 3, carboxylesterase 3 (brain), EC 3.1.1, EC 3.1.1.1, ES31FLJ21736, Esterase 31, Liver carboxylesterase 31 homolog | 
| Accession # | Q8VCT4 | 
| Formulation | Lyophilized from a 0.2 μm filtered solution of 20mM Tris,150mM NaCl,pH8.0. | 
| Shipping | The product is shipped at ambient temperature. | 
| Reconstitution | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. | 
| Storage | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. | 
| Purity | Greater than 95% as determined by reducing SDS-PAGE. | 
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. | 
| Amino Acid Sequence | 
					YPSSPPVVNTVKGKVLGKYVNLEGFTQPVAVFLGVPFAKPPLGSLRFAPPQPAEPWSFVKNTTSY PPMCSQDAVGGQVLSELFTNRKENIPLQFSEDCLYLNIYTPADLTKNSRLPVMVWIHGGGLVVGG ASTYDGLALSAHENVVVVTIQYRLGIWGFFSTGDEHSRGNWGHLDQVAALRWVQDNIANFGGNPG SVTIFGESAGGFSVSVLVLSPLAKNLFHRAISESGVSLTAALITTDVKPIAGLVATLSGCKTTTS AVMVHCLRQKTEDELLETSLKLNLFKLDLLGNPKESYPFLPTVIDGVVLPKAPEEILAEKSFSTV PYIVGINKQEFGWIIPTLMGYPLAEGKLDQKTANSLLWKSYPTLKISENMIPVVAEKYLGGTDDL TKKKDLFQDLMADVVFGVPSVIVSRSHRDAGASTYMYEFEYRPSFVSAMRPKAVIGDHGDEIFSV FGSPFLKDGASEEETNLSKMVMKFWANFARNGNPNGGGLPHWPEYDQKEGYLKIGASTQAAQRLK DKEVSFWAELRAKESAQRPSHREVDHHHHHH
				 | 
| Background | Mouse Carboxylesterases 3 (CES3) is a member of five families of mammalian carboxylesterases that plays a role in catalyzing hydrolytic and transesterification reactions with xenobiotics, anticancer pro-drugs and narcotics, and detoxifying organophosphates and insecticides. Mammalian carboxylesterases are enzymes with broad substrate specificities ranging from small molecule esters to longchain fatty acid esters. It is shown that CESs has key roles in the metabolism of a wide variety of clinical drugs, illicit narcotics and chemical nerve agents. CES3 is broadly expressed in liver, colon and brain. | 


 


 
              








