Recombinant Human Isocitrate Dehydrogenase 1/IDH1

Instruction Manual!

Product name:	Recombinant Human Isocitrate Dehydrogenase 1/IDH1
Source:	E.coli
Purity:	Greater than 94% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 50mM Tris, 200mM NaCl, 10% glycerol, pH8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Isocitrate Dehydrogenase is produced by our E.coli expression system and the target gene encoding Met1-Leu414 is expressed with a 8His tag at the C-terminus.
Names	Isocitrate Dehydrogenase [NADP] Cytoplasmic, IDH, Cytosolic NADP-Isocitrate Dehydrogenase, IDP, NADP(+)-Specific ICDH, Oxalosuccinate Decarboxylase, IDH1, PICD
Accession #	O75874
Formulation	Supplied as a 0.2 μm filtered solution of 50mM Tris, 200mM NaCl, 10% glycerol, pH8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 94% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg).
Amino Acid Sequence	MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDAAEAIK KHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLVSGWVKPIII GHHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHS SFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFEAQKIWYEHRLIDDMVAQAMK SEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQET STNPIASIFAWTRGLAHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSD YLNTFEFMDKLGENLKIKLAQAKLSLEHHHHHHHH
Background	Isocitrate Dehydrogenase [NADP] Cytoplasmic (IDH1) belongs to the isocitrate and isopropylmalate dehydrogenases family. IDH1 exists as a homodimer, binding one magnesium or manganese ion per subunit. Mutations of IDH1 have been shown to cause metaphyseal chondromatosis with aciduria and are involved in the development of glioma. IDH plays a role in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the α-hydroxylation of phytanic acid.