Recombinant Human Aldehyde Dehydrogenase 1-A3/ALDH1A3
| Product name: | Recombinant Human Aldehyde Dehydrogenase 1-A3/ALDH1A3 | 
| Source: | E.coli | 
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. | 
| Buffer Formulation: | Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mMNaCl, pH7.5,20% Glycerol. | 
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. | 
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. | 
| UOM: | 100ug/50ug/200ug/1mg/1g | 
| Source | E.coli | 
| Description | Recombinant Human Aldehyde dehydrogenase 1-A3 is produced by our E.coli expression system and the target gene encoding Met1-Pro512 is expressed with a 6His tag at the N-terminus. | 
| Names | Aldehyde dehydrogenase family 1 member A3, ALDH1A3, Aldehyde dehydrogenase 6, Retinaldehyde dehydrogenase 3, RALDH-3, ALDH6 | 
| Accession # | P47895 | 
| Formulation | Supplied as a 0.2 μm filtered solution of 20mM TrisHCl,150mMNaCl, pH7.5,20% Glycerol. | 
| Shipping | The product is shipped on dry ice/ice packs. | 
| Storage | Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. | 
| Purity | Greater than 95% as determined by reducing SDS-PAGE. | 
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. | 
| Amino Acid Sequence | 
					MNHKVHHHHHHMATANGAVENGQPDRKPPALPRPIRNLEVKFTKIFINNEWHESKSGKKFATCNP STREQICEVEEGDKPDVDKAVEAAQVAFQRGSPWRRLDALSRGRLLHQLADLVERDRATLAALET MDTGKPFLHAFFIDLEGCIRTLRYFAGWADKIQGKTIPTDDNVVCFTRHEPIGVCGAITPWNFPL LMLVWKLAPALCCGNTMVLKPAEQTPLTALYLGSLIKEAGFPPGVVNIVPGFGPTVGAAISSHPQ INKIAFTGSTEVGKLVKEAASRSNLKRVTLELGGKNPCIVCADADLDLAVECAHQGVFFNQGQCC TAASRVFVEEQVYSEFVRRSVEYAKKRPVGDPFDVKTEQGPQIDQKQFDKILELIESGKKEGAKL ECGGSAMEDKGLFIKPTVFSEVTDNMRIAKEEIFGPVQPILKFKSIEEVIKRANSTDYGLTAAVF TKNLDKALKLASALESGTVWINCYNALYAQAPFGGFKMSGNGRELGEYALAEYTEVKTVTIKLGD KNP
				 | 
| Background | Aldehyde dehydrogenase 1 family member A3 (ALDH1A3), also known as retinaldehyde dehydrogenase 3 (RALDH3), is a member of the aldehyde dehydrogenase family known to metabolize a wide variety of aldehydes. ALDH1A3 specifically oxidizes retinal to retinoic acid (RA) and is differentially expressed in developing embryonic tissues and adult organs. The RA produced by ALDH1A3 in rodents contributes to the development of skin and hair follicles, brain, tooth buds, lungs, olfactory bulbs, kidneys, eyes, skeletal muscle and seminal vesicles. In recent research, ALDH1A3 could be as a marker of cancer stem cell to predict metastasis or clinical prognosis in many cancers. | 


 


 
              








