Recombinant Human Gastric Triacylglycerol Lipase/LIPF
| Product name: | Recombinant Human Gastric Triacylglycerol Lipase/LIPF | 
| Source: | Human Cells | 
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. | 
| Buffer Formulation: | Supplied as a 0.2 μm filtered solution of 25mM TrisHCl, 100mM glycine, 10%glycerol,pH 7.3. | 
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. | 
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. | 
| UOM: | 100ug/50ug/200ug/1mg/1g | 
| Source | Human Cells | 
| Description | Recombinant Human Gastric Triacylglycerol Lipase is produced by our Mammalian expression system and the target gene encoding Leu20-Lys398 is expressed with a 6His tag at the C-terminus. | 
| Names | Gastric Triacylglycerol Lipase, GL, Gastric Lipase, LIPF | 
| Accession # | P07098 | 
| Formulation | Supplied as a 0.2 μm filtered solution of 25mM TrisHCl, 100mM glycine, 10%glycerol,pH 7.3. | 
| Shipping | The product is shipped on dry ice/ice packs. | 
| Storage | Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. | 
| Purity | Greater than 95% as determined by reducing SDS-PAGE. | 
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. | 
| Amino Acid Sequence | 
					LFGKLHPGSPEVTMNISQMITYWGYPNEEYEVVTEDGYILEVNRIPYGKKNSGNTGQRPVVFLQH GLLASATNWISNLPNNSLAFILADAGYDVWLGNSRGNTWARRNLYYSPDSVEFWAFSFDEMAKYD LPATIDFIVKKAGQKQLHYVGHSQGTTIGFIAFSTNPSLAKRIKTFYALAPVATVKYTKSLINKL RFVPQSLFKFIFGDKIFYPHNFFDQFLATEVCSREMLNLLCSNALFIICGFDSKNFNTSRLDVYL SHNPAGTSVQNMFHWTQAVKSGKFQAYDWGSPVQNRMHYDQSQPPYYNVTAMNVPIAVWNGGKDL LADPQDVGLLLPKLPNLIYHKEIPFYNHLDFIWAMDAPQEVYNDIVSMISEDKKVDHHHHHH
				 | 
| Background | Gastric Triacylglycerol Lipase (LIPF) belongs to the AB hydrolase superfamily. LIPF is an important lipase during the digestion of dietary lipids in cystic fibrosis. LIPF is involved in the digestion of dietary triglycerides in the gastrointestinal tract, and responsible for 30% of fat digestion processes occurring in human. LIPF is secreted by gastric chief cells in the fundic mucosa of the stomach, and it hydrolyzes the ester bonds of triglycerides under acidic pH conditions. LIPF acts distinct roles in neutral lipid metabolism. | 


 


 
              








