Recombinant Human Isopentenyl Pyrophosphate Isomerase 2//IPPI2/IDI2

Instruction Manual!

Product name:	Recombinant Human Isopentenyl Pyrophosphate Isomerase 2//IPPI2/IDI2
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 1mM DTT, 0.1mM PMSF, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human IPP Isomerase 2 is produced by our E.coli expression system and the target gene encoding Met1-Val227 is expressed with a 6His tag at the N-terminus.
Names	Isopentenyl-Diphosphate Delta-Isomerase 2, Isopentenyl Pyrophosphate Isomerase 2, IPP Isomerase 2, IPPI2, IDI2
Accession #	Q9BXS1
Formulation	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 1mM DTT, 0.1mM PMSF, pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGSSHHHHHHSSGLVPRGSHMSDINLDWVDRRQLQRLEEMLIVVDENDKVIGADTKRNCHLNENI EKGLLHRAFSVVLFNTKNRILIQQRSDTKVTFPGYFTDSCSSHPLYNPAELEEKDAIGVRRAAQR RLQAELGIPGEQISPEDIVFMTIYHHKAKSDRIWGEHEICYLLLVRKNVTLNPDPSETKSILYLS QEELWELLEREARGEVKVTPWLRTIAERFLYRWWPHLDDVTPFVELHKIHRV
Background	Isopentenyl Pyrophosphate Isomerase 2 (IDI2) belongs to the IPP isomerase type 1 family. Both isozymes, IDI1 and IDI2 are localized to the peroxisome by a PTS1-dependent pathway. IDI2 is expressed in skeletal muscle, which contains one nudix hydrolase domain. IDI2 binds one magnesium per subunit. IDI2 catalyzes the 1,3-allylic rearrangement of the homoallylic substrate isopentenyl (IPP) to its highly electrophilic allylic isomer, dimethylallyl diphosphate (DMAPP). It is reported that IDI2 is regulated independently from IDI1, by a mechanism that may involve PPAR-α.