Recombinant Human Signal Transducer CD24/CD24

Instruction Manual!

Product name:	Recombinant Human Signal Transducer CD24/CD24
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human Signal Transducer CD24 is produced by our Mammalian expression system and the target gene encoding Ser27-Gly59 is expressed with a Fc tag at the C-terminus.
Names	Signal transducer CD24; Small cell lung carcinoma cluster 4 antigen; CD24; CD24A
Accession #	P25063
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	SETTTGTSSNSSQSTSNTGLAPNPTNATTKAAGIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFL FPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLT VLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGF YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYT QKSLSLSPGK
Background	Signal Transducer CD24 is a heavily and variably glycosylated GPI-linked sialoprotein. Human CD24 is expressed on B lineage cells and granulocytes, on epithelial, neuronal, and muscle cells, and on a range of tumor cells. CD24 expression is regulated during lineage development and with the activation of various cell types. Antibody crosslinking of CD24 enhances the induction of apoptosis in B and T lymphocytes which contributes to negative selection and the induction of immune tolerance. CD24 on antigen presenting cells cooperates with B7 molecules in the costimulation of T cells. CD24 associates in cis with Siglec10 and with the danger-associated molecules HMGB1, HSP70, or HSP90 which are released from necrotic or damaged cells. Formation of these ternary complexes fills a protective role: the resulting Siglec10 signaling inhibits inflammatory responses that are otherwise induced by extracellular DAMPs.