Recombinant Human Bcl-2-like Protein 11/BIML
| Product name: | Recombinant Human Bcl-2-like Protein 11/BIML | 
| Source: | E.coli | 
| Purity: | Greater than 95% as determined by reducing SDS-PAGE. | 
| Buffer Formulation: | Supplied as a 0.2 μm filtered solution of 20mM HEPES, 150mM NaCl, 10% glycerol, 2mM DTT, pH8.0 | 
| Applications: | Applications:SDS-PAGE; WB; ELISA; IP. | 
| Storage: | Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months. | 
| UOM: | 100ug/50ug/200ug/1mg/1g | 
| Source | E.coli | 
| Description | Recombinant Human Bcl-2-like Protein 11 is produced by our E.coli expression system and the target gene encoding Met1-Arg120 is expressed with a 6His tag at the N-terminus. | 
| Names | Bcl-2-like protein 11; Bcl2-L-11; Bcl2-interacting mediator of cell death; BCL2L11; BIM; BIML | 
| Accession # | O43521-2 | 
| Formulation | Supplied as a 0.2 μm filtered solution of 20mM HEPES, 150mM NaCl, 10% glycerol, 2mM DTT, pH8.0 | 
| Shipping | The product is shipped on dry ice/ice packs. | 
| Storage | Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles. | 
| Purity | Greater than 95% as determined by reducing SDS-PAGE. | 
| Endotoxin | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. | 
| Amino Acid Sequence | 
					MNHKVHHHHHHMAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKST QTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHP R
				 | 
| Background | BIML is one of several splice variants of BIM, a proapoptotic protein belonging to the BH-3 domain-only subgroup of Bcl-2 family members. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. BIML is thought to promote apoptosis by binding and inhibiting the activity of anti-apoptotic Bcl-2 family members, thereby inducing the release of cytochrome c from mitochondria. BIML is normally sequestered in an inactive conformation from anti-apoptotic Bcl-2 family members through binding to the microtubule-associated dynein motor complex. Certain apoptotic stimuli release BIML from microtubules to neutralize anti-apoptotic Bcl-2 family members, allowing for the initiation of apoptosis. | 


 


 
              








