Recombinant Human SLAM Family Member 5/SLAMF5/CD84

Instruction Manual!

Product name:	Recombinant Human SLAM Family Member 5/SLAMF5/CD84
Source:	Human Cells
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	Human Cells
Description	Recombinant Human SLAM Family Member 5 is produced by our Mammalian expression system and the target gene encoding Lys22-Arg220 is expressed with a 6His tag at the C-terminus.
Names	SLAM family member 5; Cell surface antigen MAX.3; Hly9-beta; Leukocyte differentiation antigen CD84; Signaling lymphocytic activation molecule 5; CD84; SLAMF5
Accession #	Q9UIB8
Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	KDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIH ALGPNYNLVISDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCNV TLTCSVEKEEKNVTYNWSPLGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIA MGFRHHHHHH
Background	SLAM family member 5 (SLAMF5/CD84) is a type I transmembrane protein in the SLAM subgroup of the CD2 family. SLAM family proteins regulate multiple aspects of immune system function. Mature human CD84 consists of a 204 amino acid (aa) extracellular domain (ECD) with two Iglike domains,a 21 aa transmembrane segment, and a 99 aa cytoplasmic domain with two immunoreceptor tyrosinebased switch motifs (ITSMs). CD84 exhibits homophilic binding which is mediated by the N-terminal Ig-like domain. Ligation induces tyrosine phosphorylation in the cytoplasmic ITSMs which then recruit the signaling adaptor molecules SAP (SLAM-associated protein) and EAT-2(EWS/Fli1-activated transcript 2).CD84 signaling inhibits Fc epsilon RI-induced mast cell activation but enhances platelet activation. LPS-induced macrophage activation,T cell proliferation and IFN-γproduction, and the interactions between T cells and B cells that are required for germinal center formation.